PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0024s0417.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 423aa    MW: 46920.2 Da    PI: 8.0577
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0024s0417.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.8e-3396154160
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          ldDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Kaladp0024s0417.2.p  96 LDDGYNWRKYGQKSVKGSENPRSYYKCTFTNCPTKKKVERSL-EGHITEIVYKGSHNHPK 154
                          59****************************************.***************85 PP

2WRKY105.62.6e-33251309159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d k v++tYeg+Hnh+
  Kaladp0024s0417.2.p 251 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFFGCPVRKHVERASQDLKSVITTYEGKHNHD 309
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.65291155IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-2892155IPR003657WRKY domain
SuperFamilySSF1182905.62E-2594155IPR003657WRKY domain
SMARTSM007741.5E-3596154IPR003657WRKY domain
PfamPF031069.9E-2597153IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-37236311IPR003657WRKY domain
SuperFamilySSF1182903.14E-29243311IPR003657WRKY domain
PROSITE profilePS5081137.505246311IPR003657WRKY domain
SMARTSM007742.5E-38251310IPR003657WRKY domain
PfamPF031065.9E-26252309IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MKAEQDENNY SNFSFQPQTT SSIYDQQTSA AFMDDTMSKQ LEWSFNTHPK QTDLSSNVIQ  60
TAAQAESRPM QTNSNMQNGT AVASSRTNIG GKQRRLDDGY NWRKYGQKSV KGSENPRSYY  120
KCTFTNCPTK KKVERSLEGH ITEIVYKGSH NHPKPQSTRR SSSSSLYGCC ESENGRTESG  180
GTPENSSTSM GEDEFEHGSP LSKSGDDNDV NEPDSKRWKG ENEIESAAGS GSRTVREPRI  240
VVQTTSEIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTFF GCPVRKHVER ASQDLKSVIT  300
TYEGKHNHDV PAARGSHSYS MIKPSSSANA PLAIRPTAAT VSSANHTSNY SNSLQASRPS  360
LQTTTSQAPF TLEMMQDPGS FGFSGFGKPS CNYGSQPQTD SFFSRAKEEP KDDQFFFDQF  420
LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-3796312878Probable WRKY transcription factor 4
1wj2_A1e-3796312878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026547.11e-152RNI-like superfamily protein
SwissprotQ8S8P51e-120WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A061EXQ11e-152A0A061EXQ1_THECC; RNI-like superfamily protein
TrEMBLA0A140H8N11e-156A0A140H8N1_MANES; WRKY transcription factor 27
STRINGPOPTR_0016s13600.11e-145(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-118WRKY DNA-binding protein 33